PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462919188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family Nin-like
Protein Properties Length: 1094aa    MW: 121004 Da    PI: 7.4466
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462919188genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28497548152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  462919188 497 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 548
                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541487568IPR003035RWP-RK domain
PfamPF020427.8E-26500548IPR003035RWP-RK domain
SuperFamilySSF542774.25E-20767862No hitNo description
SMARTSM006665.7E-24777859IPR000270PB1 domain
PfamPF005647.1E-15777858IPR000270PB1 domain
PROSITE profilePS5174518.652777859IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.6E-24777858No hitNo description
CDDcd064071.10E-32778858No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1094 aa     Download sequence    Send to blast
MGNSDTTSKR VEQINHKWQL HLSLDGDGTD NSSLFKERLT QALRYFKDST DQHLLVQVWA  60
PVKNGDRYVL TTSGQPFVLD HQSIGLLQYR AVSMMYMFSV DGDNAGELGL PGRVYKQKVP  120
EWTPNVQYYS SNEYPRLNHA ISYNVHGTVA LPVFDPSAQS CIAVVELIMT SKKINYACEV  180
DKVCKALEAV NLKSTEIFDH PNVQICNEGR QTALVEILEI LTVVCEEHKL PLAQTWVPCK  240
YRSVLAHGGG LKKSCLSFDG SCMGEVCMST SDVAFHVIDA HMWGFRDACV EHHLQRGQGV  300
PGKAFISHKP CFSKDIRQFC KLEYPLVHYA RMFGLAGCLA ICLQSCYTGH DDYILEFFLP  360
PDCIDEDDQN ALLESILTRM KKCLRSLKVV GDRDLNGVSL QLGNVLKIEN EEFKKDVQFD  420
NSEGCLRESP EGDTRGRVHE FDTETKRVSN MPEGHILADD QSQDNGTSAT RQNGSGASDS  480
SLLHKTNKPP ERRRGKAEKT ISLDVLQQYF SGSLKNAAKS LGVCPTTMKR ICRQHGISRW  540
PSRKINKVNR SLSKLKQVIE SVQGSDAAFN LTSITGPLPI PVGPSSDSLN IEKVTQSKVA  600
DLSNPADGDR DSSLQKSLEN DGHFGILMAQ QGFMDNNNSK NHLKMMVILQ GFMDNNNDAQ  660
LEADKASHSR SSSGEGSINS RTSEGSCQGS PANQTFVCKP IASTFAEPQI NPEEFTKEPF  720
QEPQLPLSRM LIEDSGSSKD LKNLFTSAAD QPFFATPTDQ PFFAPPSNLR SMKHSGTVTI  780
KASFKEDIVR FRFPCSGSVT VLKDEVAKRL RMDVGMFDIK YLDDDHEWVK LACNADLEEC  840
MEISRHSGTH VIRLLVSDIA AHLGSSCGSS EKTSAGFGLG GVVFSLKHPT IPSDSVGPIV  900
LICTLEHIGF MRGTNRESRE GVLFVRNGFD TVIPSREFGQ PNIPVNKWPY AKHYPEFANF  960
ATFGSRQDKE ANWRTSSWKD EWLVFSTMIG GSKTCVSVTA AAFQHGGPAS VKSGESTAIG  1020
EPKYQIPFGI PKGEAVKTPH LIFKNRNISS ISENTLHFKG TRVNRLGKRN MGVQFNLVCA  1080
ATNTKVKLGS INKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0853590.0BT085359.2 Zea mays full-length cDNA clone ZM_BFc0002J20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967359.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3XE990.0K3XE99_SETIT; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein